PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna08694.1-v1.0-hybrid
Common NameMYB33
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family MYB
Protein Properties Length: 310aa    MW: 34060.8 Da    PI: 5.4009
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna08694.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding45.51.8e-141461148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             +g+W + Ed+ll+ ++k +G g W+ +a++ g++R++k+c++rw +yl
  mrna08694.1-v1.0-hybrid 14 KGAWLEAEDKLLLGYIKNHGEGKWSNVAKETGLKRCGKSCRLRWMNYL 61
                             799*******************************************97 PP

2Myb_DNA-binding50.64.4e-1667111147
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                              rg+ + +E+el+++++k+lG++ W++Ia +++ gRt++++k++w++ 
  mrna08694.1-v1.0-hybrid  67 RGSISDDEEELIIRLHKLLGNR-WSLIAGRLP-GRTDNEIKNYWNSN 111
                              78889*****************.*********.***********976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.7E-22664IPR009057Homeodomain-like
PROSITE profilePS5129417.371961IPR017930Myb domain
SuperFamilySSF466897.03E-2712108IPR009057Homeodomain-like
SMARTSM007175.0E-121363IPR001005SANT/Myb domain
PfamPF002491.2E-131461IPR001005SANT/Myb domain
CDDcd001675.39E-101661No hitNo description
PROSITE profilePS5129424.91462116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.8E-2465116IPR009057Homeodomain-like
SMARTSM007172.5E-1566114IPR001005SANT/Myb domain
PfamPF002492.8E-1467111IPR001005SANT/Myb domain
CDDcd001676.05E-1271112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 310 aa     Download sequence    Send to blast
MGRGPRCSKD GLNKGAWLEA EDKLLLGYIK NHGEGKWSNV AKETGLKRCG KSCRLRWMNY  60
LRPDIKRGSI SDDEEELIIR LHKLLGNRWS LIAGRLPGRT DNEIKNYWNS NLAKKMAQAA  120
AQTSSQSKCN NAIVQRTPDG TQPQQQYSRV NTVIPTQPPP ATAAAAASPV HHRSLNDFSN  180
SVAMNNTNDL VKAINSVDSH MSREDGSPST TTTTNTTGDG DDRLGSSPTN FMLDFNTDDH  240
EDFCKILDCD FANLNSAIDG DDDHQGSPVL ELPKQMMDKN MQAADFGSLA SFLESDEDWL  300
GNDLNVMLS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-281211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHQ7027510.0HQ702751.1 Fragaria vesca MYB domain class transcription factor (MYB33) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001266978.10.0transcription factor MYB28-like
TrEMBLE9NS170.0E9NS17_FRAVE; MYB domain class transcription factor
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G22640.16e-55myb domain protein 3